Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizobium radiobacter Conjugal transfer protein trbF(trbF)

Recombinant Rhizobium radiobacter Conjugal transfer protein trbF(trbF)

SKU:CSB-CF345024RKV

Regular price €1.503,95 EUR
Regular price Sale price €1.503,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter)

Uniprot NO.:P54914

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGTTPPDNPYIAARNEWNERYGSYVKAAAAWRIVGITGMTMAVIGFGYALYQSTQVKLI PYIVEVDKLGTAVNAGFPQQIEYADPRVVRATLGSFVSNFRSVTPDAVVQKQYIDRTYGL LRTSDPATEKVNAWFRSNSPFEKAKTATVAIEVNNIVALSNQSYQVDWTEFERDRRGKET ATRRFRGIATVTLTPPQDEGVIRLNPIGLYLRDFDWTAQL

Protein Names:Recommended name: Conjugal transfer protein trbF

Gene Names:Name:trbF

Expression Region:1-220

Sequence Info:full length protein

View full details