Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizobium meliloti Nitrogen fixation protein fixH(fixH)

Recombinant Rhizobium meliloti Nitrogen fixation protein fixH(fixH)

SKU:CSB-CF322435RKU

Regular price €1.449,95 EUR
Regular price Sale price €1.449,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)

Uniprot NO.:P18397

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTATKQRSPKRGFTGWHMVAVMSLFFGTVISVNLVMAWNASRSWSGLVVENTYVASQQF NGKVAEGRAFQASGIKGRLTTEPGAIRYVLTRNGEPEQKIDKVIAVLKRPVEEHEDLRVE LHPRGEGAFVLAEELKPGQWIAAMMAMAGDAVVHRQTIRFIAEGRDK

Protein Names:Recommended name: Nitrogen fixation protein fixH

Gene Names:Name:fixH Ordered Locus Names:RA0660 ORF Names:SMa1210

Expression Region:1-167

Sequence Info:full length protein

View full details