Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Zinc transporter ZIP13(Slc39a13),partial

Recombinant Rat Zinc transporter ZIP13(Slc39a13),partial

SKU:CSB-EP644804RA

Regular price €865,95 EUR
Regular price Sale price €865,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q2M1K6

Gene Names: Slc39a13

Organism: Rattus norvegicus (Rat)

AA Sequence: WAYTCNISPGVEGQSLQRQQQLGLWVIAGFLTFLALEKMFLNCKEEDPSQAPSKDPTAAALNGGHCLAQPAAEPGLRAVVRNLKVSGYLNLLANTIDNFTHGLA

Expression Region: 130-233aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-GST-tagged

MW: 41.2 kDa

Alternative Name(s): Solute carrier family 39 member 13Zrt- and Irt-like protein 13 ;ZIP-13

Relevance: Acts as a zinc-influx transporter.

Reference: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details