Gene Bio Systems
Recombinant Rat V-type proton ATPase subunit e 1(Atp6v0e1)
Recombinant Rat V-type proton ATPase subunit e 1(Atp6v0e1)
SKU:CSB-CF755280RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:Q794C0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AYHGLTVPLIVMSVFWGFVGLLVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLN PLFGPQLKNETIWYLKYHWP
Protein Names:Recommended name: V-type proton ATPase subunit e 1 Short name= V-ATPase subunit e 1 Alternative name(s): D-serine-regulated transcript 1 protein Short name= DSR-1 V-ATPase 9.2 kDa membrane accessory protein V-ATPase M9.2 subu
Gene Names:Name:Atp6v0e1 Synonyms:Atp6v0e, Dsr1
Expression Region:2-81
Sequence Info:full length protein
