Recombinant Rat Trypsin-4(Try4)

Recombinant Rat Trypsin-4(Try4)

CSB-YP319450RA
Regular price
€713,95 EUR
Sale price
€713,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Cell Biology

Target / Protein: Try4

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Rattus norvegicus (Rat)

Delivery time: 3-7 business days

Uniprot ID: P12788

AA Sequence: IVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHCYKRKLQVRLGEHNIHVLEGGEQFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSLPRSCASTDAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFCLGFLEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQETMANN

Tag info: N-terminal 6xHis-tagged

Expression Region: 24-247aa

Protein length: Full Length of Mature Protein

MW: 26.1 kDa

Alternative Name(s): Pretrypsinogen IV Trypsin IV

Relevance:

Reference: "A fourth trypsinogen (P23) in the rat pancreas induced by CCK." Luetcke H.A., Rausch U., Vasiloudes P., Scheele G.A., Kern H.F. Nucleic Acids Res. 17:6736-6736(1989)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share