Gene Bio Systems
Recombinant Rat Transmembrane protein 35(Tmem35)
Recombinant Rat Transmembrane protein 35(Tmem35)
SKU:CSB-CF023830RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:Q6JAM9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MASPRTITIVALSVALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVRALPLLKKMGIN SILLRKSIGALEVACGIVMTLVPGRPKDVANFFLLLLVLAVLFFHQLVGDPLKRYAHALV FGILLTCRLLIARKPEDRSSEKKALPESAEEQPSLYEKAPQGKVKVS
Protein Names:Recommended name: Transmembrane protein 35 Alternative name(s): Spinal cord expression protein 4 TMEM35 gene-derived unknown factor 1
Gene Names:Name:Tmem35 Synonyms:Tuf1
Expression Region:1-167
Sequence Info:full length protein
