Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat T-cell surface antigen CD2(Cd2)

Recombinant Rat T-cell surface antigen CD2(Cd2)

SKU:CSB-CF004894RA

Regular price €1.603,95 EUR
Regular price Sale price €1.603,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P08921

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RDSGTVWGALGHGINLNIPNFQMTDDIDEVRWERGSTLVAEFKRKMKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILDKALDLRILEMVSKPMIYWECSNATLTCEVLEGTDVELKLYQGKEHLRSLRQKTMSYQWTNLRAPFKCKAVNRVSQESEMEVVNCPEKGLPLYLIVGVSAGGLLLVFFGALFIFCICKRKKRNRRRKGEELEIKASRMSTVERGPKPHSTQASAPASQNPVASQAPPPPGHHLQTPGHRPLPPSHRNREHQPKKRPPPSGTQVHQQKGPPLPRPRVQPKPPCGSGDVSLPPPN

Protein Names:Recommended name: T-cell surface antigen CD2 Alternative name(s): LFA-2 LFA-3 receptor OX-34 antigen T-cell surface antigen T11/Leu-5 CD_antigen= CD2

Gene Names:Name:Cd2

Expression Region:23-344

Sequence Info:full length protein

View full details