Skip to product information
1 of 1

GeneBio Systems

Recombinant Rat Purine nucleoside phosphorylase (Pnp)

Recombinant Rat Purine nucleoside phosphorylase (Pnp)

SKU:P85973

Regular price €1.713,95 EUR
Regular price Sale price €1.713,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P85973

Gene Names: Pnp

Alternative Name(s): (PNP)(Inosine phosphorylase)(Inosine-guanosine phosphorylase)

Abbreviation: Recombinant Rat Pnp protein

Organism: Rattus norvegicus (Rat)

Source: Baculovirus

Expression Region: 1-289aa

Protein Length: Full Length

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: MENEFTYEDYQRTAEWLRSHTKHRPQVAVICGSGLGGLTAKLTQPQAFDYNEIPNFPQSTVQGHAGRLVFGFLNGRSCVMMQGRFHMYEGYSLSKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFCGQNPLRGPNDERFGVRFPAMSDAYDRDMRQKAFNAWKQMGEQRELQEGTYIMSAGPTFETVAESCLLRMLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVVMDYNNLEKASHQEVLEAGKAAAQKLEQFVSILMESIPPRERAN

MW: 33.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Catalyzes the phosphorolytic breakdown of the N-glycosidic bond in the beta-(deoxy)ribonucleoside molecules, with the formation of the corresponding free purine bases and pentose-1-phosphate. Preferentially acts on 6-oxopurine nucleosides including inosine and guanosine.

Reference: "Purine nucleoside phosphorylase inhibition ameliorates age-associated lower urinary tract dysfunctions." Birder L.A., Wolf-Johnston A., Wein A.J., Cheng F., Grove-Sullivan M., Kanai A.J., Watson A.M., Stoltz D., Watkins S.C., Robertson A.M., Newman D., Dmochowski R.R., Jackson E.K. JCI Insight 5: 140109-140109(2020)

Function:

View full details