Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Probable N-acetyltransferase CML6(Cml6)

Recombinant Rat Probable N-acetyltransferase CML6(Cml6)

SKU:CSB-CF862373RA

Regular price €1.504,95 EUR
Regular price Sale price €1.504,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:Q9JIY6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVSYHICEYQDSDYKSVVDVFTKGAEEYIPSTFRHLLLLPRTLLLLLGVSLALVLVSGSW LLAVVCIFFLLPFLWFLAGQPWKNYVSKCLHTDMADITKSYLSDRGSGFWVAESGEQVVG TVGALPVKEPPSGRKQLQLFHLAVSSQHRGQGIAKALVRTVLQFARDQGYTDVVLETSTM QIGAVTLYLGMGFQKTGQYFPSMLWRLVGIRFVQLNYSFPSA

Protein Names:Recommended name: Probable N-acetyltransferase CML6 EC= 2.3.1.- Alternative name(s): Camello-like protein 1 Camello-like protein 6

Gene Names:Name:Cml6 Synonyms:Cml1

Expression Region:1-222

Sequence Info:full length protein

View full details