Gene Bio Systems
Recombinant Rat Oxidized low-density lipoprotein receptor 1(Olr1)
Recombinant Rat Oxidized low-density lipoprotein receptor 1(Olr1)
SKU:CSB-CF016331RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:O70156
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAFDDKMKPVNGQPDQKSCGKKPKGLHLLSSTWWCPAAVTLAILCLVLSVTLIVQQTQLLQVSDLLKQYQANLTQQDHILEGQMSAQKKAENASQESKRELKEQIDTLTWKLNEKSKEQEKLLQQNQNLQEALQRAVNASEESKWELKEQIDILNWKLNGISKEQKELLQQNQNLQEALQKAEKYSEESQRELKEQIDTLSWKLNEKSKEQEELLQQNQNLQEALQRAANSSGPCPQDWIWHKENCYLFHGPFNWEKSRENCLSLDAQLLQISTTDDLNFVLQATSHSTSPFWMGLHRKNPNHPWLWENGSPLSFQFFRTRGVSLQMYSSGTCAYIQGGVVFAENCILTAFSICQKKANLLLTQ
Protein Names:Recommended name: Oxidized low-density lipoprotein receptor 1 Short name= Ox-LDL receptor 1 Alternative name(s): Lectin-like oxidized LDL receptor 1 Short name= LOX-1 Short name= Lectin-like oxLDL receptor 1 Lectin-type oxidized LDL receptor 1 Cleaved into the following chain: 1. Oxidized low-density lipoprotein receptor 1, soluble form
Gene Names:Name:Olr1 Synonyms:Lox1, Oldlr1
Expression Region:1-364
Sequence Info:full length protein
