Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Neuron-specific vesicular protein calcyon(Caly)

Recombinant Rat Neuron-specific vesicular protein calcyon(Caly)

SKU:CSB-CF004461RA

Regular price €1.507,95 EUR
Regular price Sale price €1.507,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P58821

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVKLGCSFSGKPGKETGDQDGAAMDSVPLISPLDVSQLQPSFPDQVVIKTQTEYQLTSADQPKKFADLEGQRLACSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLRHKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTEMPAIWGNSYRAGKEEHKGTTPAAMTVSTAAAAAAAEGNEPSGKPLDMREKEDPQKAEDVPSQSPK

Protein Names:Recommended name: Neuron-specific vesicular protein calcyon

Gene Names:Name:Caly Synonyms:Drd1ip

Expression Region:1-226

Sequence Info:full length protein

View full details