Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Matrilysin(Mmp7)

Recombinant Rat Matrilysin(Mmp7)

SKU:CSB-EP014677RA

Regular price €776,95 EUR
Regular price Sale price €776,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P50280

Gene Names: Mmp7

Organism: Rattus norvegicus (Rat)

AA Sequence: FSLMPNSPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNKL

Expression Region: 98-267aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 45.9 kDa

Alternative Name(s): Matrin;Matrix metalloproteinase-7 ;MMP-7Pump-1 proteaseUterine metalloproteinase

Relevance: Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase .

Reference: Characterization of rat uterine matrilysin and its cDNA. Relationship to human pump-1 and activation of procollagenases.Abramson S.R., Conner G.E., Nagase H., Neuhaus I., Woessner J.F.J. Biol. Chem. 270:16016-16022(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details