Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Lysosome-associated membrane glycoprotein 1(Lamp1)

Recombinant Rat Lysosome-associated membrane glycoprotein 1(Lamp1)

SKU:CSB-CF012738RA

Regular price €1.664,95 EUR
Regular price Sale price €1.664,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P14562

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:APALFEVKDNNGTACIMASFSASFLTTYDAGHVSKVSNMTLPASAEVLKNSSSCGEKNASEPTLAITFGEGYLLKLTFTKNTTRYSVQHMYFTYNLSDTQFFPNASSKGPDTVDSTTDIKADINKTYRCVSDIRVYMKNVTIVLWDATIQAYLPSSNFSKEETRCPQDQPSPTTGPPSPSPPLVPTNPSVSKYNVTGDNGTCLLASMALQLNITYMKKDNTTVTRAFNINPSDKYSGTCGAQLVTLKVGNKSRVLELQFGMNATSSLFFLQGVQLNMTLPDAIEPTFSTSNYSLKALQASVGNSYKCNSEEHIFVSKALALNVFSVQVQAFRVESDRFGSVEECVQDGNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI

Protein Names:Recommended name: Lysosome-associated membrane glycoprotein 1 Short name= LAMP-1 Short name= Lysosome-associated membrane protein 1 Alternative name(s): 120 kDa lysosomal membrane glycoprotein Short name= LGP-120 CD107 antigen-like family member A CD_antigen= CD107a

Gene Names:Name:Lamp1 Synonyms:Lamp-1

Expression Region:22-407

Sequence Info:full length protein

View full details