Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Lipoma HMGIC fusion partner-like 1 protein(Lhfpl1)

Recombinant Rat Lipoma HMGIC fusion partner-like 1 protein(Lhfpl1)

SKU:CSB-CF767338RA

Regular price €1.485,95 EUR
Regular price Sale price €1.485,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:Q80WE5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:STSYFLPYWLFGSQLGKPVSFSTFRRCNYPVRGDGHNLIMVEECGRYASFAAIPSLAWQM CTVVTGAGCALLLLVALAAVLGCCMEELISRMMGRCMGAAQFVGGLLISSGCALYPLGWN SPEVMQTCGNVSNQFQLGTCRLGWAYYCAGGGAAAAMLICTWLSCFAGRNPKPVMLVENI MRNTNSYAMELDHCLKP

Protein Names:Recommended name: Lipoma HMGIC fusion partner-like 1 protein

Gene Names:Name:Lhfpl1 Synonyms:Lhfp

Expression Region:24-220

Sequence Info:full length protein

View full details