Skip to product information
1 of 1

GeneBio Systems

Recombinant Rat Leukemia inhibitory factor (Lif)

Recombinant Rat Leukemia inhibitory factor (Lif)

SKU:P17777

Regular price €667,95 EUR
Regular price Sale price €667,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Immunology

Uniprot ID: P17777

Gene Names: Lif

Alternative Name(s): LIF;Cholinergic neuronal differentiation factor

Abbreviation: Recombinant Rat Lif protein

Organism: Rattus norvegicus (Rat)

Source: Yeast

Expression Region: 23-202aa

Protein Length: Full Length of Mature Protein

Tag Info: C-terminal 6xHis-Myc-tagged

Target Protein Sequence: SPLPITPVNATCAIRHPCHGNLMNQIKSQLAQLNGSANALFISYYTAQGEPFPNNVDKLCAPNMTDFPPFHANGTEKTKLVELYRMVTYLGASLTNITWDQKNLNPTAVSLQIKLNATTDVMRGLLSSVLCRLCNKYHVGHVDVPCVPDNSSKEAFQRKKLGCQLLGTYKQVISVLAQAF

MW: 23.5 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.

Reference:

Function:

View full details