Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Lens fiber membrane intrinsic protein(Lim2)

Recombinant Rat Lens fiber membrane intrinsic protein(Lim2)

SKU:CSB-CF012946RA

Regular price €1.456,95 EUR
Regular price Sale price €1.456,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P54825

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYSFMGGGLFCAWVGTILLVVATATDHWMQYRLSGSFAHQGLWRYCLGNKCFLQTESIAY WNATRAFMILSALCATSGIIMGVLAFAQQSTFTRLSRPFSAGIMFFASTLFVLLALAIYT GVTVSFLGRRFGDWRFSWSYILGWVALLMTFFAGIFYMCAYRMHECRRLSTPR

Protein Names:Recommended name: Lens fiber membrane intrinsic protein Alternative name(s): MP17 MP18 MP19 MP20

Gene Names:Name:Lim2

Expression Region:1-173

Sequence Info:Full length protein

View full details