Gene Bio Systems
Recombinant Rat High affinity copper uptake protein 1(Slc31a1)
Recombinant Rat High affinity copper uptake protein 1(Slc31a1)
SKU:CSB-CF862390RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:Q9JK41
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRMNHMEMHHMGMNHTDDNITMPPHQHPTTSASHSHEMMMPMTFYFGFKNVDLLFSSLVI NTPGEMAGAFVAVFLLAMFYEGLKIAREGLLRKSQVSIRYNSMPVPGPNGTILMETHKTV GQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVV DITEHCH
Protein Names:Recommended name: High affinity copper uptake protein 1 Alternative name(s): Copper transporter 1 Short name= rCTR1 Liver regeneration-related protein LRRGT00200 Solute carrier family 31 member 1
Gene Names:Name:Slc31a1 Synonyms:Copt1, Ctr1
Expression Region:1-187
Sequence Info:full length protein
