Recombinant Rat Hemopexin(Hpx)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Rat Hemopexin(Hpx)

CSB-EP010723RA
Regular price
€638,95 EUR
Sale price
€638,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P20059

Gene Names: Hpx

Organism: Rattus norvegicus (Rat)

AA Sequence: NPLPAAHETVAKGENGTKPDSDVIEHCSDAWSFDATTMDHNGTMLFFKGEFVWRGHSGIRELISERWKNPVTSVDAAFRGPDSVFLIKEDKVWVYPPEKKENGYPKLFQEEFPGIPYPPDAAVECHRGECQSEGVLFFQGNRKWFWDFATRTQKERSWPAVGNCTAALRWLERYYCFQGNKFLRFNPVTGEVPPRYPLDARDYFISCPGRGHGKLRNGTAHGNSTHPMHSRCNADPGLSALLSDHRGATYAFSGSHYWRLDSSRDGWHSWPIAHHWPQGPSAVDAAFSWDEKVYLIQGTQVYVFLTKGGNNLVSGYPKRLEKELGSPPGISLDTIDAAFSCPGSSKLYVTSGRRLWWLDLKSGAQATWAELSWPHEKVDGALCLEKSLGPYSCSSNGPNLFFIHGPNLYCYSSIDKLNAAKSLPQPQKVNSILGCSQ

Expression Region: 24-460aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 52.9 kDa

Alternative Name(s):

Relevance: Binds he and transports it to the liver for breakdown and iron recovery, after which the free hopexin returns to the circulation.

Reference: Rat hemopexin. Molecular cloning, primary structural characterization, and analysis of gene expression.Nikkilae H., Gitlin J.D., Mueller-Eberhard U.Biochemistry 30:823-829(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Rat Hemopexin(Hpx)
    Regular price
    €635,95 EUR
    Sale price
    €635,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Rat Hemopexin(Hpx)
    Regular price
    €638,95 EUR
    Sale price
    €638,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Rat pigment epithelium-derived factor(Serpinf1)
    Regular price
    €638,95 EUR
    Sale price
    €638,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Rat Hepatocyte growth factor(Hgf),partial
    Regular price
    €638,95 EUR
    Sale price
    €638,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share