Gene Bio Systems
Recombinant Rat Group XVI phospholipase A1-A2(Pla2g16)
Recombinant Rat Group XVI phospholipase A1-A2(Pla2g16)
SKU:CSB-CF018089RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:P53817
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPIPEPKPGDLIEIFRPMYSHWAIYVGDGYVIHLAPPSEIPGAGAASIMSALTDKAIVKKELLRDVAGKDKYQVNNKHDKEYTPLPLNKIIQRAEELVGQEVLYRLTSENCEHFVNELRYGVPRSDQVRDAVKVATVTGVGLAALGLIGVMLSRNKKQKQ
Protein Names:Recommended name: Group XVI phospholipase A1/A2 EC= 3.1.1.32 EC= 3.1.1.4 Alternative name(s): H-rev 107 protein HRAS-like suppressor 3
Gene Names:Name:Pla2g16 Synonyms:H-rev107, Hrasls3, Hrev107
Expression Region:1-160
Sequence Info:full length protein
