Recombinant Rat Golgi SNAP receptor complex member 2(Gosr2)

SKU: CSB-CF009678RA

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:O35165

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEPLYQQTHKQVHEIQSHMGRLETADKQSVHLVENEIQASIDQIFSHLERLEILSSKEPPNRRQNAKLRVDQLKYDVQHLQTALRNFQHRRQAKEQQERQRDELLSRTFTTNDSDTTIPMDESLQFNSSLQNIHHGMDDLIGGGHSILEGLRAQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCAVMFLVVQYLT

Protein Names:Recommended name: Golgi SNAP receptor complex member 2 Alternative name(s): 27 kDa Golgi SNARE protein Membrin

Gene Names:Name:Gosr2 Synonyms:Gs27

Expression Region:1-212

Sequence Info:full length protein