Recombinant Rat Fibroblast growth factor 23(Fgf23)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Rat Fibroblast growth factor 23(Fgf23)

CSB-EP008629RA
Regular price
€782,95 EUR
Sale price
€782,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q8VI82

Gene Names: Fgf23

Organism: Rattus norvegicus (Rat)

AA Sequence: YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV

Expression Region: 25-251aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 29.5 kDa

Alternative Name(s):

Relevance: Regulator of phosphate homeostasis . Inhibits renal tubular phosphate transport by reducing SLC34A1 levels . Regulator of vitamin-D metabolism . Negatively regulates osteoblasts differentiation and matrix mineralization . Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL.

Reference: Rattus norvegicus fgf23.Itoh N.Klotho converts canonical FGF receptor into a specific receptor for FGF23.Urakawa I., Yamazaki Y., Shimada T., Iijima K., Hasegawa H., Okawa K., Fujita T., Fukumoto S., Yamashita T.Nature 444:770-774(2006)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Rat Fibroblast growth factor 23(Fgf23)
    Regular price
    €780,95 EUR
    Sale price
    €780,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Rat Hepatocyte growth factor(Hgf),partial
    Regular price
    €782,95 EUR
    Sale price
    €782,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Rat Hepatocyte growth factor(Hgf),partial
    Regular price
    €782,95 EUR
    Sale price
    €782,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Rat Insulin-like growth factor-binding protein 1(Igfbp1)
    Regular price
    €782,95 EUR
    Sale price
    €782,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share