Recombinant Rat Carbonic anhydrase 1(Ca1)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Rat Carbonic anhydrase 1(Ca1)

CSB-EP004364RAa2
Regular price
€779,95 EUR
Sale price
€779,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: B0BNN3

Gene Names: Ca1

Organism: Rattus norvegicus (Rat)

AA Sequence: ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF

Expression Region: 2-261aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 44.2 kDa

Alternative Name(s): Carbonate dehydratase I

Relevance: Reversible hydration of carbon dioxide.Curated

Reference: Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Proteome profile of the mature rat olfactory bulb.Maurya D.K., Sundaram C.S., Bhargava P.Proteomics 9:2593-2599(2009)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Rat Carbonic anhydrase 1(Ca1)
    Regular price
    €779,95 EUR
    Sale price
    €779,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Rat Carbonic anhydrase 1(Ca1)
    Regular price
    €776,95 EUR
    Sale price
    €776,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Carbonic anhydrase 1(CA1)
    Regular price
    €609,95 EUR
    Sale price
    €609,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Carbonic anhydrase 1(CA1)
    Regular price
    €680,95 EUR
    Sale price
    €680,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share