Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Brain protein 44-like protein(Brp44l)

Recombinant Rat Brain protein 44-like protein(Brp44l)

SKU:CSB-CF002817RA

Regular price €1.390,95 EUR
Regular price Sale price €1.390,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P63031

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCC YSLTFMRFAYKVQPRNWLLFACHVTNEVAQLIQGGRLINYEMSKRPSA

Protein Names:Recommended name: Brain protein 44-like protein Alternative name(s): Apoptosis-regulating basic protein

Gene Names:Name:Brp44l Synonyms:Arbp

Expression Region:2-109

Sequence Info:Full length protein

View full details