Gene Bio Systems
Recombinant Rat Brain-derived neurotrophic factor(Bdnf),partial
Recombinant Rat Brain-derived neurotrophic factor(Bdnf),partial
SKU:CSB-RP166394r
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P23363
Gene Names: Bdnf
Organism: Rattus norvegicus (Rat)
AA Sequence: RRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTL
Expression Region: 136-243aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 16.3 kDa
Alternative Name(s):
Relevance: During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systs. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS .
Reference: Multiple promoters direct tissue-specific expression of the rat BDNF gene.Timmusk T., Palm K., Metsis M., Reintam T., Palme V., Saarma M., Persson H.Neuron 10:475-489(1993)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.