Recombinant Rat Basic leucine zipper transcriptional factor ATF-like 3(Batf3)

Recombinant Rat Basic leucine zipper transcriptional factor ATF-like 3(Batf3)

CSB-EP002572RA
Regular price
€628,95 EUR
Sale price
€628,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P97876

Gene Names: Batf3

Organism: Rattus norvegicus (Rat)

AA Sequence: MSQGPPAGGVLQSSVAAPGNQPQSPKDDDRKVRRREKNRVAAQRSRKKQTQKSDKLHEEHESLEQENSVLRREIAKLKEELRHLTEALKEHEKMCPLLLCPMNFVQLRPDPVASWSAHDAPDHPSFIWLGTLV

Expression Region: 1-133aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 19.1 kDa

Alternative Name(s): Jun dimerization protein 1 ;JDP-1

Relevance: AP-1 family transcription factor that controls the differentiation of CD8+ thymic conventional dendritic cells in the immune syst. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes. Required for development of CD8-alpha+ classical dendritic cells (cDCs) and related CD103+ dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens .

Reference: Isolation of an AP-1 repressor by a novel method for detecting protein-protein interactions.Aronheim A., Zandi E., Hennemann H., Elledge S.J., Karin M.Mol. Cell. Biol. 17:3094-3102(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share