Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Apolipoprotein C-I(Apoc1)

Recombinant Rat Apolipoprotein C-I(Apoc1)

SKU:CSB-MP001930RA

Regular price €2.400,95 EUR
Regular price Sale price €2.400,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Cardiovascular

Uniprot ID:P19939

Gene Names:Apoc1

Organism:Rattus norvegicus (Rat)

AA Sequence:APDFSSAMESLPDKLKEFGNTLEDKARAAIEHIKQKEIMIKTRNWFSETLNKMKEKLKTTFA

Expression Region:27-88aa

Sequence Info:Full Length of Mature Protein

Source:Mammalian cell

Tag Info:C-terminal hFc-tagged

MW:34.7 kDa

Alternative Name(s):Apolipoprotein C1 ?Liver regeneration-related protein LRRG04?

Relevance:Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein.

Reference:"Human apoA-I expression in CETP transgenic rats leads to lower levels of apoC-I in HDL and to magnification of CETP-mediated lipoprotein changes." Masson D., Pais de Barros J.P., Zak Z., Gautier T., Le Guern N., Assem M., Chisholm J.W., Paterniti J.R. Jr., Lagrost L. J. Lipid Res. 47:356-365(2006)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein.

Involvement in disease:

Subcellular Location:Secreted

Protein Families:Apolipoprotein C1 family

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Rn&CID=8887

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?rno:108348160

STRING Database Link:https://string-db.org/network/10116.ENSRNOP00000040585

OMIM Database Link:

Lead Time Guidance:18-28 business days

View full details