Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Ankyrin repeat domain-containing protein 46(Ankrd46)

Recombinant Rat Ankyrin repeat domain-containing protein 46(Ankrd46)

SKU:CSB-CF755243RA

Regular price €1.511,95 EUR
Regular price Sale price €1.511,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:Q76K24

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSYVFVNDSSQTNVPLLQACIDGDFTYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDI CQLLHKFGADPLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGV NKDVIRLLESLEEQEVKGFNRGTHSKLETMQTAESESAMESHSLLNPNLQQGEGVLSSFR TTWQEFVEDLGFWRVLLLILVIALLSLGIAYYVSGVLPFVDNQPGLVH

Protein Names:Recommended name: Ankyrin repeat domain-containing protein 46 Alternative name(s): Ankyrin repeat small protein Short name= ANK-S

Gene Names:Name:Ankrd46

Expression Region:1-228

Sequence Info:full length protein

View full details