Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rabbit Tumor necrosis factor ligand superfamily member 4(TNFSF4)

Recombinant Rabbit Tumor necrosis factor ligand superfamily member 4(TNFSF4)

SKU:CSB-CF023994RB

Regular price €1.466,95 EUR
Regular price Sale price €1.466,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryctolagus cuniculus (Rabbit)

Uniprot NO.:O02765

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEGVRPLEENVGNAPRPRFERNKLLLVASVVQALGLLLCLTYVCQHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP

Protein Names:Recommended name: Tumor necrosis factor ligand superfamily member 4 Alternative name(s): OX40 ligand Short name= OX40L CD_antigen= CD252

Gene Names:Name:TNFSF4 Synonyms:TXGP1

Expression Region:1-187

Sequence Info:full length protein

View full details