Recombinant Pyrococcus horikoshii L-aspartate oxidase(nadB)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Pyrococcus horikoshii L-aspartate oxidase(nadB)

CSB-EP527569FHX
Regular price
€916,95 EUR
Sale price
€916,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: O57765

Gene Names: nadB

Organism: Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139)

AA Sequence: MMEMRVGIVGGGLAGLTAAIALAEKGFDVSIIGPRSTDSNSYLAQAGIALPLLEGDSIRIHVLDTIKAGKYINDEEIVWNVISKSSEAHDFLTSHGVTFTGNELEGGHSYPRIFTIKSETGKHIIPILEKHARELDVNFIRGFVEEIGINNGKLAGVFLQGELLKFDAVVIAAGGFSGLYRFTAGVKNNIGLLIGDVALKGVPLRDMEFVQFHPTGFIGKRTYLITEAVRGAGAKLVTGDGERFVNELETRDIVARAIYMKMLEGKGVFLDARGIENFKDRFPYIYSVLRGEGINPEKDLIPITPVAHYTIGGISVDAFYRTRIKGLYAIGESACNGFHGANRLASNSLLECVVSGLEVARTISREKPKREVNDAPYSFNELGDVDSIREVLWNHAGIVRDEWSLREGLRKLKEIEVDERLKLVAKAVIISALKREESRGAHYRKDYPFMRKEFEHSSFFYPNV

Expression Region: 1-464aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

MW: 71.3 kDa

Alternative Name(s): Quinolinate synthase B

Relevance: Catalyzes the oxidation of L-aspartate to iminoaspartate.

Reference: "Complete sequence and gene organization of the genome of a hyper-thermophilic archaebacterium, Pyrococcus horikoshii OT3." Kawarabayasi Y., Sawada M., Horikawa H., Haikawa Y., Hino Y., Yamamoto S., Sekine M., Baba S., Kosugi H., Hosoyama A., Nagai Y., Sakai M., Ogura K., Otsuka R., Nakazawa H., Takamiya M., Ohfuku Y., Funahashi T. Kikuchi H. DNA Res. 5:55-76(1998)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Escherichia coli L-aspartate oxidase(nadB)
    Regular price
    €780,95 EUR
    Sale price
    €780,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Escherichia coli Pyruvate dehydrogenase [ubiquinone](poxB),partial
    Regular price
    €916,95 EUR
    Sale price
    €916,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Escherichia coli Pyruvate dehydrogenase [ubiquinone](poxB)
    Regular price
    €916,95 EUR
    Sale price
    €916,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Escherichia coli Pyruvate kinase I(pykF)
    Regular price
    €720,95 EUR
    Sale price
    €720,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share