Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pyrococcus abyssi UPF0056 membrane protein PYRAB13050(PYRAB13050)

Recombinant Pyrococcus abyssi UPF0056 membrane protein PYRAB13050(PYRAB13050)

SKU:CSB-CF891708FHV

Regular price €1.480,95 EUR
Regular price Sale price €1.480,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pyrococcus abyssi (strain GE5 / Orsay)

Uniprot NO.:Q9UZ49

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLEVLKTFAVLYVGLFAITNPVGAVPIFMGVVSHLAPDKRHEVAEKVSITVLVTLLTFAL VGKWIFKFFGSSVDAFAIAGGILLFRMGMEMLSGKLSSVKIDEEDVTLEEVAVIPLAIPL ISGPGAITTVMLYMTRESPPIVIATIIAIGISVYIILASGNKIIEKLGRVGIKVTTRMMG LILTSMAIQMIINGIKGAFGI

Protein Names:Recommended name: UPF0056 membrane protein PYRAB13050

Gene Names:Ordered Locus Names:PYRAB13050 ORF Names:PAB0863

Expression Region:1-201

Sequence Info:full length protein

View full details