Gene Bio Systems
Recombinant Pyrobaculum calidifontis UPF0290 protein Pcal_2086 (Pcal_2086)
Recombinant Pyrobaculum calidifontis UPF0290 protein Pcal_2086 (Pcal_2086)
SKU:CSB-CF386695PZV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pyrobaculum calidifontis (strain JCM 11548 / VA1)
Uniprot NO.:A3MXY4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNEIVQLFLLIWPPYVANGSAVLAARLRRRHPLDFGKNFLDGRRIFGDGKTFEGVAIGVS AGTLLGYAPNLAYSYLTLLDAFLLATAAIVGDLLGAFVKRRLCMPRGYPAFPLDQLDFLL MALLVYSLYRELHIPLLLAAVVLTPVIHRATNYAAYKLRLKKEPW
Protein Names:Recommended name: UPF0290 protein Pcal_2086
Gene Names:Ordered Locus Names:Pcal_2086
Expression Region:1-165
Sequence Info:full length protein
