Skip to product information
1 of 1

Gene Bio Systems

Recombinant Psychrobacter arcticus UPF0060 membrane protein Psyc_0916(Psyc_0916)

Recombinant Psychrobacter arcticus UPF0060 membrane protein Psyc_0916(Psyc_0916)

SKU:CSB-CF670074PAAV

Regular price €1.400,95 EUR
Regular price Sale price €1.400,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Psychrobacter arcticus (strain DSM 17307 / 273-4)

Uniprot NO.:Q4FT89

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSELKTVGLFAITALAEIAGCYLPYLWLREGKSIWLLIPGALSLVAFVWLLSLHPTAAGR TYAAYGGVYISMAILWLWTVNGIRPTTWDIVGSVVALIGMAIIMFAPRSV

Protein Names:Recommended name: UPF0060 membrane protein Psyc_0916

Gene Names:Ordered Locus Names:Psyc_0916

Expression Region:1-110

Sequence Info:full length protein

View full details