Gene Bio Systems
Recombinant Pseudomonas syringae pv. tomato UPF0060 membrane protein PSPTO_1628(PSPTO_1628)
Recombinant Pseudomonas syringae pv. tomato UPF0060 membrane protein PSPTO_1628(PSPTO_1628)
SKU:CSB-CF801520FGP
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pseudomonas syringae pv. tomato (strain DC3000)
Uniprot NO.:Q886F1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLNYLWFFLAALFEIAGCYAFWLWLRQGKSALWVIPALISLTLFALLLTRVEAAYAGRAY AAYGGIYIVASIAWLGLVERVRPLGTDWLGLAFCVIGATIILLGPRWSAP
Protein Names:Recommended name: UPF0060 membrane protein PSPTO_1628
Gene Names:Ordered Locus Names:PSPTO_1628
Expression Region:1-110
Sequence Info:full length protein
