Recombinant Pseudomonas syringae pv. syringae  Protein-export membrane protein SecG(secG)

Recombinant Pseudomonas syringae pv. syringae Protein-export membrane protein SecG(secG)

CSB-CF309828PWE
Regular price
€1.020,95 EUR
Sale price
€1.020,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudomonas syringae pv. syringae (strain B728a)

Uniprot NO.:P95577

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAIL AACFFITSLGLGYFAKEKAQQLTQVGLPDPAVLEVKQKPAADDVPVLEGQKPAAVPADVP QAPEKK

Protein Names:Recommended name: Protein-export membrane protein SecG

Gene Names:Name:secG Ordered Locus Names:Psyr_4183

Expression Region:1-126

Sequence Info:full length protein

Your list is ready to share