Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas putida ATP synthase protein I(atpI)

Recombinant Pseudomonas putida ATP synthase protein I(atpI)

SKU:CSB-CF363017FFZ

Regular price €1.417,95 EUR
Regular price Sale price €1.417,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudomonas putida (Arthrobacter siderocapsulatus)

Uniprot NO.:P0A104

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEIRTPNRLPFHRWAVFPVLLAQFVVLLLATLVLWQWKGSVSGYSGLCGGLIAWLPNVYF AWKAFRFSGARAAQAIVKSFYAGEAGKMILTAVLFALTFAGVKPLAPLAVFGVFVLTLLV SWFAPLLMNKRLSRP

Protein Names:Recommended name: ATP synthase protein I

Gene Names:Name:atpI Synonyms:uncI

Expression Region:1-135

Sequence Info:full length protein

View full details