Gene Bio Systems
Recombinant Pseudomonas phage phi6 Major envelope protein(P9)
Recombinant Pseudomonas phage phi6 Major envelope protein(P9)
SKU:CSB-CF362170PUV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pseudomonas phage phi6 (Bacteriophage phi-6)
Uniprot NO.:P07581
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPFPLVKQDPTSKAFTEASERSTGTQILDVVKAPIGLFGDDAKHEFVTRQEQAVSVVSWA VAAGLIGELIGYRGARSGRKAILANIPFLA
Protein Names:Recommended name: Major envelope protein Alternative name(s): Protein P9
Gene Names:Name:P9
Expression Region:1-90
Sequence Info:full length protein
