Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas aeruginosa UPF0059 membrane protein PLES_21541 (PLES_21541)

Recombinant Pseudomonas aeruginosa UPF0059 membrane protein PLES_21541 (PLES_21541)

SKU:CSB-CF489551EZY

Regular price €1.465,95 EUR
Regular price Sale price €1.465,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pseudomonas aeruginosa (strain LESB58)

Uniprot NO.:B7V6V8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNPVSLIFLAFAMSTDAFAAAIGKGSSLDRPRLSEALRTGIIFGVIEAITPLVGWLLGQA ASQFVADWDHWIAFVLLVLLGLHMIHNGLRADHETEQEKPGQHSFWILAVTALATSIDAL AVGVGLAFVDVNIFLAAGAIGLATMTMVTLGTMLGRALGAVTGKRAEMVGGVVLILVGAT ILYEHLSAA

Protein Names:Recommended name: UPF0059 membrane protein PLES_21541

Gene Names:Ordered Locus Names:PLES_21541

Expression Region:1-189

Sequence Info:full length protein

View full details