Gene Bio Systems
Recombinant Pseudoalteromonas phage PM2 Protein P3(III)
Recombinant Pseudoalteromonas phage PM2 Protein P3(III)
SKU:CSB-CF896404PTQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pseudoalteromonas phage PM2 (Bacteriophage PM2)
Uniprot NO.:Q9XJR6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNTSVPTSVPTNQSVWGNVSTGLDALISGWARVEQIKAAKASTGQGRVEQAMTPELDNGA AVVVEAPKKAAQPSETLVFGVPQKTLLLGFGGLLVLGLVMRGNK
Protein Names:Recommended name: Protein P3 Alternative name(s): Protein III
Gene Names:Name:III
Expression Region:1-104
Sequence Info:full length protein
