Gene Bio Systems
Recombinant Pseudoalteromonas haloplanktis UPF0060 membrane protein PSHAa1175(PSHAa1175)
Recombinant Pseudoalteromonas haloplanktis UPF0060 membrane protein PSHAa1175(PSHAa1175)
SKU:CSB-CF668258PTP
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pseudoalteromonas haloplanktis (strain TAC 125)
Uniprot NO.:Q3IKL0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKIFGLFLITALAEIIGCYLPYLWLREGKSVWLLVPAALSLAIFAWLLSLHPAAAGRVYA AYGGVYIFMAILWLWAVDGIRPTTWDLVGSGVALVGMAIIMFAPRSV
Protein Names:Recommended name: UPF0060 membrane protein PSHAa1175
Gene Names:Ordered Locus Names:PSHAa1175
Expression Region:1-107
Sequence Info:full length protein
