Gene Bio Systems
Recombinant Pseudoalteromonas atlantica ATP synthase subunit b 2(atpF2)
Recombinant Pseudoalteromonas atlantica ATP synthase subunit b 2(atpF2)
SKU:CSB-CF621892PAAJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Uniprot NO.:Q15MU0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNINATLFGELLAFIFFVWFCMKFVWPPIMGAIEERQKKIADGLAASERGEKDLELAQAK ATEQLKEAKTQAAGIIEQAKKRGSQIVDEETQRAHQERENIIAQGHAEIEAERNRAKEDL RKQVAALAVAGAERILERQIDAAAQSDIVEKLVAEL
Protein Names:Recommended name: ATP synthase subunit b 2 Alternative name(s): ATP synthase F(0) sector subunit b 2 ATPase subunit I 2 F-type ATPase subunit b 2 Short name= F-ATPase subunit b 2
Gene Names:Name:atpF2 Ordered Locus Names:Patl_4299
Expression Region:1-156
Sequence Info:full length protein
