Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudechis porphyriacus Basic phospholipase A2 pseudexin B chain

Recombinant Pseudechis porphyriacus Basic phospholipase A2 pseudexin B chain

SKU:CSB-YP018091EZTa4

Regular price €879,95 EUR
Regular price Sale price €879,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P20259

Gene Names: N/A

Organism: Pseudechis porphyriacus (Red-bellied black snake)

AA Sequence: NLIQFSNMIKCAIPGSRPLFQYADYGCYCGPGGHGTPVDELDRCCKIHDDCYGEAGKKGCFPKLTLYSWKCTEKVPTCNAKSRCKDFVCACDAEAAKCFAKAPYIKENYNINTKTRC

Expression Region: 1-117aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-sumostar-tagged

MW: 29 kDa

Alternative Name(s): Phosphatidylcholine 2-acylhydrolase

Relevance: PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.

Reference: "Purification, sequencing and characterization of pseudexin phospholipases A2 from Pseudechis porphyriacus (Australian red-bellied black snake)." Schmidt J.J., Middlebrook J.L. Toxicon 27:805-818(1989)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details