Gene Bio Systems
Recombinant Prosthecochloris vibrioformis Lipoprotein signal peptidase(lspA)
Recombinant Prosthecochloris vibrioformis Lipoprotein signal peptidase(lspA)
SKU:CSB-CF390737PZJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Prosthecochloris vibrioformis (strain DSM 265) (Chlorobium vibrioforme subsp. thiosulfatophilum (strain DSM 265)) (Chlorobium phaeovibrioides (strain DSM 265))
Uniprot NO.:A4SDK1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRWFFFLLLSVIGLDRFTKQLAIIFLRDTGESITIIPGLFSLTYAENRGIAFGMEFLPPG VLLILTTIIVSGVIIYALYQGNRQPLFLGSFGLIAGGGIGNLIDRFTTGRVVDFLYFDLY RGELFGQWIALWPIFNIADSAITIGACMLIIFYGRIFPDSTASGGNNVC
Protein Names:Recommended name: Lipoprotein signal peptidase EC= 3.4.23.36 Alternative name(s): Prolipoprotein signal peptidase Signal peptidase II Short name= SPase II
Gene Names:Name:lspA Ordered Locus Names:Cvib_0538
Expression Region:1-169
Sequence Info:full length protein
