Skip to product information
1 of 1

Gene Bio Systems

Recombinant Prosthecochloris aestuarii Large-conductance mechanosensitive channel(mscL)

Recombinant Prosthecochloris aestuarii Large-conductance mechanosensitive channel(mscL)

SKU:CSB-CF474342EYX

Regular price €1.416,95 EUR
Regular price Sale price €1.416,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Prosthecochloris aestuarii (strain DSM 271 / SK 413)

Uniprot NO.:B4S9H4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGFIQEFKDFAMRGNVVDLAVGIIIGGAFGKVVTALVDGVLMPPIGLLIGGVNFDQLAFE LRAATAESAAVSLNYGAFLQTIVDFVIIAFSIFVVIKALNSLKRKSEEAPKAPPVPSKEE VLLGEIRDLLKERG

Protein Names:Recommended name: Large-conductance mechanosensitive channel

Gene Names:Name:mscL Ordered Locus Names:Paes_1626

Expression Region:1-134

Sequence Info:full length protein

View full details