Gene Bio Systems
Recombinant Probable protein-export membrane protein secG(secG)
Recombinant Probable protein-export membrane protein secG(secG)
SKU:CSB-CF630261EXX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Porphyra yezoensis
Uniprot NO.:Q1XDL2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEQILKFFWYSSTIILIFTILIHNPKSEGLGSVGAQNQFFSNTRSTENTLNKITWLFLVL FLLLTTIIAVS
Protein Names:Recommended name: Probable protein-export membrane protein secG
Gene Names:Name:secG Synonyms:ycf47
Expression Region:1-71
Sequence Info:full length protein
