Gene Bio Systems
Recombinant Probable disulfide formation protein C 1(bdbC1)
Recombinant Probable disulfide formation protein C 1(bdbC1)
SKU:CSB-CF800542BQE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus anthracis
Uniprot NO.:Q81UU9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGREKKQEYALFTAWGASFIATLGSLYFSEIMKFEPCVLCWYQRIFMYPFVLWLGIAVVK KDYRIASYSLPIASIGACISLYHYVIQKVAAFSAAGAACGRVPCTGEYINWFGFVTIPFL ALIGFITIAVCSFIVIKNK
Protein Names:Recommended name: Probable disulfide formation protein C 1 Alternative name(s): Disulfide oxidoreductase C 1 Thiol-disulfide oxidoreductase C 1
Gene Names:Name:bdbC1 Ordered Locus Names:BA_0758, GBAA_0758, BAS0722
Expression Region:1-139
Sequence Info:full length protein
