Skip to product information
1 of 1

Gene Bio Systems

Recombinant Probable cytochrome c oxidase polypeptide 4(ctaF)

Recombinant Probable cytochrome c oxidase polypeptide 4(ctaF)

SKU:CSB-CF748219MLA

Regular price €1.421,95 EUR
Regular price Sale price €1.421,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium paratuberculosis

Uniprot NO.:Q73YL6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHIEARLFEFIAGFFFLTALLYGVLTALFATGGEEWAGTTALALTGGLALIVATFFRFVA RRIDTRPEDYEGAEISDGAGELGFFSPHSWWPILIALSGSVAAVGIALWLPWLIVAGVMF ILSSVAGLVFEYYLGPEKH

Protein Names:Recommended name: Probable cytochrome c oxidase polypeptide 4 EC= 1.9.3.1 Alternative name(s): Cytochrome aa3 subunit 4 Cytochrome c oxidase polypeptide IV

Gene Names:Name:ctaF Ordered Locus Names:MAP_1939c

Expression Region:1-139

Sequence Info:full length protein

View full details