Recombinant Potato virus X  Movement protein TGB2 (ORF3)

Recombinant Potato virus X Movement protein TGB2 (ORF3)

CSB-CF325996PRD
Regular price
€1.015,95 EUR
Sale price
€1.015,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Potato virus X (strain CP) (PVX)

Uniprot NO.:P22593

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSAQGHRLTAPVNSEKVYIVLGLSFALISITFLLSRSNLPHVGDNIHSLPHGGAYRDGTK AVLYNSPNFGSRTSLSNGKNAAFAVVLLLSLLIYGSRCLSQRNHLCACGNNHSSH

Protein Names:Recommended name: Movement protein TGB2 Alternative name(s): 12 kDa protein Triple gene block 2 protein Short name= TGBp2

Gene Names:ORF Names:ORF3

Expression Region:1-115

Sequence Info:full length protein

Your list is ready to share