Skip to product information
1 of 1

Gene Bio Systems

Recombinant Porcine transmissible gastroenteritis coronavirus Non-structural protein 3b (3b)

Recombinant Porcine transmissible gastroenteritis coronavirus Non-structural protein 3b (3b)

SKU:CSB-CF328342PQF

Regular price €1.533,95 EUR
Regular price Sale price €1.533,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Porcine transmissible gastroenteritis coronavirus (strain FS772/70) (TGEV)

Uniprot NO.:P22656

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIGGLFLNTLSFVIVSNHSIVNNTANVHHIQQERVIVQQHQVVSAITQNYYPEFSIAVLF VSFLALYRSTNFKTCVGILMFKILSMTLLGPMLIAYGYYIDGIVTTTVLSLRFAYLAYFW YVNSRFEFILYNTTTLMFVHGRAAPFKRSSHSSIYVTLYGGINYMFVNDLTLHFVDPMLV SIAIRGLAHADLTVVRAVELLNGDFIYVFSQEPVVGVYNAAFSQAVLNEIDLKEEEGDRT YDVS

Protein Names:Recommended name: Non-structural protein 3b Short name= ns3b Alternative name(s): Accessory protein 3b Non-structural protein 3-1 X2b protein

Gene Names:ORF Names:3b

Expression Region:1-244

Sequence Info:full length protein

View full details