Skip to product information
1 of 1

Gene Bio Systems

Recombinant Porcine reproductive and respiratory syndrome virus Nucleocapsid protein(ORF7)

Recombinant Porcine reproductive and respiratory syndrome virus Nucleocapsid protein(ORF7)

SKU:CSB-EP2163

Regular price €989,95 EUR
Regular price Sale price €989,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: V5N6H2

Gene Names: ORF7

Organism: Porcine reproductive and respiratory syndrome virus (PRRSV)

AA Sequence: MPNNNGKQQKRKKGDGQPVNQLCQMLGKIITQQNQSRGKGPGKKNKKKNPEKPHFPLATEDDVRHHFTPSERQLCLSSIQTAFNQGAGTCTLSDSGRISYTVEFSLPTHHTVRLIRVTASPSA

Expression Region: 1-123aa

Sequence Info: Full Length

Source: E.coli

Tag Info: NO-tagged

MW: 13.6 kDa

Alternative Name(s):

Relevance:

Reference: "Genetic dissection of complete genomes of Type 2 PRRS viruses isolated in Denmark over a period of 15 years." Kvisgaard L.K., Hjulsager C.K., Brar M.S., Leung F.C., Larsen L.E. Vet. Microbiol. 167:334-344(2013)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details