Skip to product information
1 of 1

Gene Bio Systems

Recombinant Porcine reproductive and respiratory syndrome virus Envelope small membrane protein(GP2b)

Recombinant Porcine reproductive and respiratory syndrome virus Envelope small membrane protein(GP2b)

SKU:CSB-CF370643PYZ

Regular price €1.202,95 EUR
Regular price Sale price €1.202,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Porcine reproductive and respiratory syndrome virus (isolate Pig/United States/SD 01-08/2001) (PRRSV)

Uniprot NO.:A0MD31

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GSLWSKISQLFVDAFTEFLVSVVDIVIFLAILFGFTVAGWLLVFLLRVVCSALLRSRSAI HSPELSKVL

Protein Names:Recommended name: Envelope small membrane protein Short name= Protein E Alternative name(s): Glycoprotein 2b Short name= Protein GP2b Gs

Gene Names:Name:GP2b ORF Names:2b

Expression Region:2-70

Sequence Info:full length protein

View full details